Recombinant ATXN1 Antibody

Catalog number RC-4461-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4461-01

Size / count 50 μL

Specifications

Catalog number: RC-4461-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ataxin-1, Spinocerebellar ataxia type 1 protein
Gene Name: ATXN1
Gene ID: 6310
UniProt: P54253
Antigen Species: Human
Reactivity: Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human Ataxin 1
Partner Proteins: Ataxin-1; Spinocerebellar ataxia type 1 protein
Clone: K01_1N15
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 99%, Pig - 98%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: SPAAAPPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNLKNG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: ATX1; SCA1
Target Alternative Name: ATXN1
Panel Description: Neurodegenerative Diseases Marker, Neuroscience Biomarkers
Host or Source: Rabbit
Protein Name: Ataxin 1
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant ATXN1 Antibody?

The catalog number for Recombinant ATXN1 Antibody is RC-4461.

What sizes are available for Recombinant ATXN1 Antibody?

Recombinant ATXN1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ATXN1 Antibody come in?

Recombinant ATXN1 Antibody is available in 3 different pack sizes.

Is Recombinant ATXN1 Antibody in stock?

Recombinant ATXN1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

All Products