Recombinant GHR Antibody

Catalog number RC-5384-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5384-01

Size / count 50 μL

Specifications

Catalog number: RC-5384-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Growth hormone receptor, GH receptor, Somatotropin receptor) [Cleaved into: Growth hormone-binding protein, GH-binding protein, GHBP, Serum-binding protein]
Gene Name: GHR
Gene ID: 2690
UniProt: P10912
Antigen Species: Human
Reactivity: Rat
Cross Reactivity: Not tested
Immunogen: A synthetic peptide of human Growth hormone receptor
Partner Proteins: Growth hormone receptor; GH receptor; Somatotropin receptor) [Cleaved into: Growth hormone-binding protein; GH-binding protein; GHBP; Serum-binding protein]
Clone: K01_1R94
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: IKVESHIQPSLNQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHIVQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: GHR
Host or Source: Rabbit
Protein Name: Growth hormone receptor
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant GHR Antibody?

The catalog number for Recombinant GHR Antibody is RC-5384.

What sizes are available for Recombinant GHR Antibody?

Recombinant GHR Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant GHR Antibody come in?

Recombinant GHR Antibody is available in 3 different pack sizes.

Is Recombinant GHR Antibody in stock?

Recombinant GHR Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

All Products