Recombinant SUMF1 Antibody

Catalog number RN-14459-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14459-01

Size / count 50 μL

Specifications

Catalog number: RN-14459-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Formylglycine-generating enzyme, FGE, C-alpha-formylglycine-generating enzyme 1, Sulfatase-modifying factor 1
Gene Name: SUMF1
Gene ID: 285362
UniProt: Q8NBK3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SUMF1
Target: PP-11240
Partner Proteins: Formylglycine-generating enzyme; FGE; C-alpha-formylglycine-generating enzyme 1; Sulfatase-modifying factor 1
Clone: KCA003_20D4
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 89%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: HGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 89%
Recombinant Antibody: Yes
WB Dilution: 1:2000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SUMF1
Host or Source: Mouse
Protein Name: Sulfatase modifying factor 1
WB Description: Succeed
IP description: Fail (T-47D)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SUMF1 Antibody?

The catalog number for Recombinant SUMF1 Antibody is RN-14459.

What sizes are available for Recombinant SUMF1 Antibody?

Recombinant SUMF1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SUMF1 Antibody come in?

Recombinant SUMF1 Antibody is available in 3 different pack sizes.

Is Recombinant SUMF1 Antibody in stock?

Recombinant SUMF1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

All Products