Recombinant HSDL2 Antibody — image 1 of 2

Product details

Recombinant HSDL2 Antibody

Catalog number RN-13712-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-13712-01

Size / count 50 μL

Specifications

Catalog number: RN-13712-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Hydroxysteroid dehydrogenase-like protein 2, Short chain dehydrogenase/reductase family 13C member 1
Gene Name: HSDL2
Gene ID: 84263
UniProt: Q6YN16
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human HSDL2
Target: PP-8849
Partner Proteins: Hydroxysteroid dehydrogenase-like protein 2; Short chain dehydrogenase/reductase family 13C member 1
Clone: K1L015_7D7
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP
Validation: Top_IHC&Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 89%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: CTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEAVSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C9orf99; SDR13C1
Target Alternative Name: HSDL2
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Hydroxysteroid dehydrogenase like 2
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant HSDL2 Antibody?

The catalog number for Recombinant HSDL2 Antibody is RN-13712.

What sizes are available for Recombinant HSDL2 Antibody?

Recombinant HSDL2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant HSDL2 Antibody come in?

Recombinant HSDL2 Antibody is available in 3 different pack sizes.

Is Recombinant HSDL2 Antibody in stock?

Recombinant HSDL2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.