Recombinant GNMT Antibody

Catalog number RN-10957-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-10957-01

Size / count 50 μL

Specifications

Catalog number: RN-10957-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Glycine N-methyltransferase
Gene Name: GNMT
Gene ID: 27232
UniProt: Q14749
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GNMT
Target: PP-10622
Partner Proteins: Glycine N-methyltransferase
Clone: K9N035_8A7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: QYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: GNMT
Host or Source: Mouse
Protein Name: Glycine N-methyltransferase
IHC description: Succeed
IP description: Fail (Mouse Liver)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant GNMT Antibody?

The catalog number for Recombinant GNMT Antibody is RN-10957.

What sizes are available for Recombinant GNMT Antibody?

Recombinant GNMT Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant GNMT Antibody come in?

Recombinant GNMT Antibody is available in 3 different pack sizes.

Is Recombinant GNMT Antibody in stock?

Recombinant GNMT Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.