Recombinant RAB41 Antibody

Catalog number RN-12172-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12172-01

Size / count 50 μL

Specifications

Catalog number: RN-12172-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ras-related protein Rab-41
Gene Name: RAB41
Gene ID: 347517
UniProt: Q5JT25
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RAB41
Target: PP-7786
Partner Proteins: Ras-related protein Rab-41
Clone: K8U045_3A11
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 66%, Rat - 66%, Pig - 66%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: MEAGGFGLEAAERTEYQSLCKSKLLFLGEQSVGKTSIISRFMYNSFGCACQATVGIDFLSKTMYLEDQIVQLQLWDTAGQERFHSLIPSYIRDSTIAVVVYDITNINSFKETDKWVEHVRAERGDDVVIMLLGNKIDLDNKRQVTAEQGEEKSRNLNVMFIETSAKTGYNVKKLFRRVASALLSTRTSPPPKEGTVEIEL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 66%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: RAB41
Host or Source: Mouse
Protein Name: RAB41, member RAS oncogene family
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant RAB41 Antibody?

The catalog number for Recombinant RAB41 Antibody is RN-12172.

What sizes are available for Recombinant RAB41 Antibody?

Recombinant RAB41 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant RAB41 Antibody come in?

Recombinant RAB41 Antibody is available in 3 different pack sizes.

Is Recombinant RAB41 Antibody in stock?

Recombinant RAB41 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

All Products