Recombinant FCRL3 Antibody — image 1 of 2

Product details

Recombinant FCRL3 Antibody

Catalog number RN-12197-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12197-01

Size / count 50 μL

Specifications

Catalog number: RN-12197-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Fc receptor-like protein 3, FcR-like protein 3, FcRL3, Fc receptor homolog 3, FcRH3, IFGP family protein 3, hIFGP3, Immune receptor translocation-associated protein 3, MAIA, SH2 domain-containing phosphatase anchor protein 2, CD antigen CD307c
Gene Name: FCRL3
Gene ID: 115352
UniProt: Q96P31
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FCRL3
Target Antigen: CD307c
Target: PP-950
Partner Proteins: Fc receptor-like protein 3; FcR-like protein 3; FcRL3; Fc receptor homolog 3; FcRH3; IFGP family protein 3; hIFGP3; Immune receptor translocation-associated protein 3; MAIA; SH2 domain-containing phosphatase anchor protein 2; CD antigen CD307c
Clone: K56059_13E10
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Pig - 61%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: DPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEENYENVPRVLL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: FCRH3; IFGP3; IRTA3; SPAP2
Target Alternative Name: FCRL3
Panel Description: Neurodegenerative Diseases Marker, CD Antigen
Host or Source: Mouse
Protein Name: Fc receptor like 3
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant FCRL3 Antibody?

The catalog number for Recombinant FCRL3 Antibody is RN-12197.

What sizes are available for Recombinant FCRL3 Antibody?

Recombinant FCRL3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant FCRL3 Antibody come in?

Recombinant FCRL3 Antibody is available in 3 different pack sizes.

Is Recombinant FCRL3 Antibody in stock?

Recombinant FCRL3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

All Products