Recombinant PUS7L Antibody — image 1 of 2

Product details

Recombinant PUS7L Antibody

Catalog number RN-11168-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-11168-01

Size / count 50 μL

Specifications

Catalog number: RN-11168-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Pseudouridylate synthase PUS7L, Pseudouridylate synthase 7 homolog-like protein
Gene Name: PUS7L
Gene ID: 83448
UniProt: Q9H0K6
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PUS7L
Target: PP-7155
Partner Proteins: Pseudouridylate synthase PUS7L; Pseudouridylate synthase 7 homolog-like protein
Clone: K56063_9F7
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 66%, Pig - 75%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: FSSLCFFNDHVGFHGTIKSSPSDFIVIEIDEQGQLVNKTIDEPIFKISEIQLEPNNFPKKPKLDLQNLSLEDGRNQEVHTLIKYTDGDQNHQSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSKTELIGLPPEFSIGRILDKNQRASLHSAIRQKFPFLVTVGKNSEIVVKPNLEYKELCHLVSEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRFREKAHKRGKRPLSECQEGKV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 66%
Recombinant Antibody: Yes
WB Dilution: 1:2000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: PUS7L
Host or Source: Mouse
Protein Name: Pseudouridine synthase 7 like
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant PUS7L Antibody?

The catalog number for Recombinant PUS7L Antibody is RN-11168.

What sizes are available for Recombinant PUS7L Antibody?

Recombinant PUS7L Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PUS7L Antibody come in?

Recombinant PUS7L Antibody is available in 3 different pack sizes.

Is Recombinant PUS7L Antibody in stock?

Recombinant PUS7L Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.