Recombinant RNF138 Antibody — image 1 of 2

Product details

Recombinant RNF138 Antibody

Catalog number RN-12665-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12665-01

Size / count 50 μL

Specifications

Catalog number: RN-12665-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: E3 ubiquitin-protein ligase RNF138, Nemo-like kinase-associated RING finger protein, NLK-associated RING finger protein, hNARF, RING finger protein 138, RING-type E3 ubiquitin transferase RNF138
Gene Name: RNF138
Gene ID: 51444
UniProt: Q8WVD3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RNF138
Target: PP-8065
Partner Proteins: E3 ubiquitin-protein ligase RNF138; Nemo-like kinase-associated RING finger protein; NLK-associated RING finger protein; hNARF; RING finger protein 138; RING-type E3 ubiquitin transferase RNF138
Clone: K1E078_3F5
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 92%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: HYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NARF
Target Alternative Name: RNF138
Panel Description: E3 Ligase, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Ring finger protein 138
WB Description: Succeed
IHC description: Succeed
IP description: Fail (Jurkat)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant RNF138 Antibody?

The catalog number for Recombinant RNF138 Antibody is RN-12665.

What sizes are available for Recombinant RNF138 Antibody?

Recombinant RNF138 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant RNF138 Antibody come in?

Recombinant RNF138 Antibody is available in 3 different pack sizes.

Is Recombinant RNF138 Antibody in stock?

Recombinant RNF138 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

All Products