Recombinant HGH1 Antibody — image 1 of 2

Product details

Recombinant HGH1 Antibody

Catalog number RN-12866-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12866-01

Size / count 50 μL

Specifications

Catalog number: RN-12866-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein HGH1 homolog
Gene Name: HGH1
Gene ID: 51236
UniProt: Q9BTY7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human HGH1
Target: PP-9682
Partner Proteins: Protein HGH1 homolog
Clone: K1E084_11C2
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 91%, Pig - 80%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: EEMERLPVDLQYLPPDKQREPDADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACEKLIQVLIGDEPERGMENLLEVQVPEDVEQQLQQLDCREQEQLERELAP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Yes
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C8orf30A; C8orf30B; FAM203A; FAM203B
Target Alternative Name: HGH1
Host or Source: Mouse
Protein Name: HGH1 homolog
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant HGH1 Antibody?

The catalog number for Recombinant HGH1 Antibody is RN-12866.

What sizes are available for Recombinant HGH1 Antibody?

Recombinant HGH1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant HGH1 Antibody come in?

Recombinant HGH1 Antibody is available in 3 different pack sizes.

Is Recombinant HGH1 Antibody in stock?

Recombinant HGH1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

All Products