Recombinant SNRNP27 Antibody

Catalog number RN-12857-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12857-01

Size / count 50 μL

Specifications

Catalog number: RN-12857-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein, U4/U6.U5 snRNP 27 kDa protein, U4/U6.U5-27K, Nucleic acid-binding protein RY-1, U4/U6.U5 tri-snRNP-associated 27 kDa protein, 27K, U4/U6.U5 tri-snRNP-associated protein 3
Gene Name: SNRNP27
Gene ID: 11017
UniProt: Q8WVK2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SNRNP27
Target: PP-10477
Partner Proteins: U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein; U4/U6.U5 snRNP 27 kDa protein; U4/U6.U5-27K; Nucleic acid-binding protein RY-1; U4/U6.U5 tri-snRNP-associated 27 kDa protein; 27K; U4/U6.U5 tri-snRNP-associated protein 3
Clone: K1E087_3D2
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: RDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SNRNP27
Host or Source: Mouse
Protein Name: Small nuclear ribonucleoprotein U4/U6.U5 subunit 27
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SNRNP27 Antibody?

The catalog number for Recombinant SNRNP27 Antibody is RN-12857.

What sizes are available for Recombinant SNRNP27 Antibody?

Recombinant SNRNP27 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SNRNP27 Antibody come in?

Recombinant SNRNP27 Antibody is available in 3 different pack sizes.

Is Recombinant SNRNP27 Antibody in stock?

Recombinant SNRNP27 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.