Recombinant ECPAS Antibody

Catalog number RN-13291-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-13291-01

Size / count 50 μL

Specifications

Catalog number: RN-13291-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proteasome adapter and scaffold protein ECM29, Ecm29 proteasome adapter and scaffold, Proteasome-associated protein ECM29 homolog
Gene Name: ECPAS
Gene ID: 23392
UniProt: Q5VYK3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ECPAS
Target: PP-5879
Partner Proteins: Proteasome adapter and scaffold protein ECM29; Ecm29 proteasome adapter and scaffold; Proteasome-associated protein ECM29 homolog
Clone: K92087_10F1
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Pig - 95%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: GVRTTKNEEENEKEKELQLEYLLGAFESLGKAWPRNAETQRCYRQELCKLMCERLKLSTWKVQLGVLQSMNAFFQGLMLLEEEHADPEALAEILLETCKS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ECM29; KIAA0368
Target Alternative Name: ECPAS
Host or Source: Mouse
Protein Name: Ecm29 proteasome adaptor and scaffold
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ECPAS Antibody?

The catalog number for Recombinant ECPAS Antibody is RN-13291.

What sizes are available for Recombinant ECPAS Antibody?

Recombinant ECPAS Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ECPAS Antibody come in?

Recombinant ECPAS Antibody is available in 3 different pack sizes.

Is Recombinant ECPAS Antibody in stock?

Recombinant ECPAS Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.