Recombinant SMPD3 Antibody — image 1 of 2

Product details

Recombinant SMPD3 Antibody

Catalog number RN-13691-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-13691-01

Size / count 50 μL

Specifications

Catalog number: RN-13691-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Sphingomyelin phosphodiesterase 3, Neutral sphingomyelinase 2, nSMase-2, nSMase2, Neutral sphingomyelinase II
Gene Name: SMPD3
Gene ID: 55512
UniProt: Q9NY59
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SMPD3
Target: PP-1187
Partner Proteins: Sphingomyelin phosphodiesterase 3; Neutral sphingomyelinase 2; nSMase-2; nSMase2; Neutral sphingomyelinase II
Clone: K40093_18C12
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 91%, Pig - 91%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: NHNQQDGDSGSLGSPSASRESLVKGRAGPDTSASGEPGANSKLLYKASVVKKAAARRRRHPDEAFDHEVSAFFPANLDFL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Yes
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SMPD3
Host or Source: Mouse
Protein Name: Sphingomyelin phosphodiesterase 3
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SMPD3 Antibody?

The catalog number for Recombinant SMPD3 Antibody is RN-13691.

What sizes are available for Recombinant SMPD3 Antibody?

Recombinant SMPD3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SMPD3 Antibody come in?

Recombinant SMPD3 Antibody is available in 3 different pack sizes.

Is Recombinant SMPD3 Antibody in stock?

Recombinant SMPD3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.