Recombinant SRP19 Antibody

Catalog number RN-13774-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-13774-01

Size / count 50 μL

Specifications

Catalog number: RN-13774-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Signal recognition particle 19 kDa protein, SRP19
Gene Name: SRP19
Gene ID: 6728
UniProt: P09132
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SRP19
Target: PP-7607
Partner Proteins: Signal recognition particle 19 kDa protein; SRP19
Clone: K92094_12E4
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Pig - 98%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SRP19
Host or Source: Mouse
Protein Name: Signal recognition particle 19
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SRP19 Antibody?

The catalog number for Recombinant SRP19 Antibody is RN-13774.

What sizes are available for Recombinant SRP19 Antibody?

Recombinant SRP19 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SRP19 Antibody come in?

Recombinant SRP19 Antibody is available in 3 different pack sizes.

Is Recombinant SRP19 Antibody in stock?

Recombinant SRP19 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

All Products