Recombinant NSF Antibody

Catalog number RN-14422-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14422-01

Size / count 50 μL

Specifications

Catalog number: RN-14422-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Vesicle-fusing ATPase, N-ethylmaleimide-sensitive fusion protein, NEM-sensitive fusion protein, Vesicular-fusion protein NSF
Gene Name: NSF
Gene ID: 4905
UniProt: P46459
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NSF
Target: PP-4873
Partner Proteins: Vesicle-fusing ATPase; N-ethylmaleimide-sensitive fusion protein; NEM-sensitive fusion protein; Vesicular-fusion protein NSF
Clone: KCA013_18A7
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 94%, Pig - 97%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: CPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLKTHPSVVPGSIAFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGC
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: NSF
Host or Source: Mouse
Protein Name: N-ethylmaleimide sensitive factor, vesicle fusing ATPase
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant NSF Antibody?

The catalog number for Recombinant NSF Antibody is RN-14422.

What sizes are available for Recombinant NSF Antibody?

Recombinant NSF Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NSF Antibody come in?

Recombinant NSF Antibody is available in 3 different pack sizes.

Is Recombinant NSF Antibody in stock?

Recombinant NSF Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.