Recombinant PLS1 Antibody

Catalog number RN-14417-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14417-01

Size / count 50 μL

Specifications

Catalog number: RN-14417-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Plastin-1, Intestine-specific plastin, I-plastin
Gene Name: PLS1
Gene ID: 5357
UniProt: Q14651
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PLS1
Target: PP-5861
Partner Proteins: Plastin-1; Intestine-specific plastin; I-plastin
Clone: KCA014_3D5
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 80%, Pig - 92%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EELMKLSPEELLLRWVNYHLTNAGWHTISNFSQDIKDSRAYFHLLNQIAPKGGEDGPAIAIDLSGINETNDLKRAGLMLQEADKLGCKQFVTPADVVSGNPKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIAGQDLNEGNSTLTLALVWQLM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: PLS1
Host or Source: Mouse
Protein Name: Plastin 1
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant PLS1 Antibody?

The catalog number for Recombinant PLS1 Antibody is RN-14417.

What sizes are available for Recombinant PLS1 Antibody?

Recombinant PLS1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PLS1 Antibody come in?

Recombinant PLS1 Antibody is available in 3 different pack sizes.

Is Recombinant PLS1 Antibody in stock?

Recombinant PLS1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

All Products