Recombinant HMCES Antibody — image 1 of 2

Product details

Recombinant HMCES Antibody

Catalog number RN-14606-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14606-01

Size / count 50 μL

Specifications

Catalog number: RN-14606-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Abasic site processing protein HMCES, Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein, ES cell-specific 5hmC-binding protein, Peptidase HMCES, SRAP domain-containing protein 1
Gene Name: HMCES
Gene ID: 56941
UniProt: Q96FZ2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human HMCES
Target: PP-6557
Partner Proteins: Abasic site processing protein HMCES; Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein; ES cell-specific 5hmC-binding protein; Peptidase HMCES; SRAP domain-containing protein 1
Clone: K9N049_13C3
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 76%, Pig - 80%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: NNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C3orf37; DC12; SRAPD1
Target Alternative Name: HMCES
Host or Source: Mouse
Protein Name: 5-Hydroxymethylcytosine binding, ES cell specific
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant HMCES Antibody?

The catalog number for Recombinant HMCES Antibody is RN-14606.

What sizes are available for Recombinant HMCES Antibody?

Recombinant HMCES Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant HMCES Antibody come in?

Recombinant HMCES Antibody is available in 3 different pack sizes.

Is Recombinant HMCES Antibody in stock?

Recombinant HMCES Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.