LINC01356 Antibody

Catalog number KC-32429-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-32429-01

Size / count 50 μL

Specifications

Catalog number: KC-32429-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative uncharacterized protein encoded by LINC01356
Gene Name: LINC01356
Gene ID: 100996702
UniProt: Q8N9X3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LINC01356
Target: PP-9924
Partner Proteins: Putative uncharacterized protein encoded by LINC01356
Clone: K1L018_7B8
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Purity: ≥85%
Cores: RVGELPEVTELVSGPDWNPNTSQPMPGSPAPAPRRLPGCQRHPHPFKCCPVPAPQSLPSTTRPHLPPTPQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: LINC01356
Host or Source: Mouse
Protein Name: Long intergenic non-protein coding RNA 1356
WB Description: Fail (HeLa)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for LINC01356 Antibody?

The catalog number for LINC01356 Antibody is KC-32429.

What sizes are available for LINC01356 Antibody?

LINC01356 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does LINC01356 Antibody come in?

LINC01356 Antibody is available in 3 different pack sizes.

Is LINC01356 Antibody in stock?

LINC01356 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

All Products