Glutamate Receptor 1 Antibody — image 1 of 3

Product details

Glutamate Receptor 1 Antibody

Catalog number KC-31970-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-31970-01

Size / count 50 μL

Specifications

Catalog number: KC-31970-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Glutamate receptor 1, GluR-1, AMPA-selective glutamate receptor 1, GluR-A, GluR-K1, Glutamate receptor ionotropic, AMPA 1, GluA1
Gene Name: GRIA1
Gene ID: 2890
UniProt: P42261
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human GRIA1
Target: PP-290
Partner Proteins: Glutamate receptor 1; GluR-1; AMPA-selective glutamate receptor 1; GluR-A; GluR-K1; Glutamate receptor ionotropic; AMPA 1; GluA1
Clone: K9N047_2G9
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: AATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: GLUA1; GLUH1; GLUR1
Target Alternative Name: Glutamate Receptor 1
Panel Description: Autoimmune Disease
Host or Source: Mouse
Protein Name: Glutamate ionotropic receptor AMPA type subunit 1
WB Description: Fail (Mouse Brain)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Glutamate Receptor 1 Antibody?

The catalog number for Glutamate Receptor 1 Antibody is KC-31970.

What sizes are available for Glutamate Receptor 1 Antibody?

Glutamate Receptor 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Glutamate Receptor 1 Antibody come in?

Glutamate Receptor 1 Antibody is available in 3 different pack sizes.

Is Glutamate Receptor 1 Antibody in stock?

Glutamate Receptor 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

All Products