Recombinant SYCP3 Antibody

Catalog number RN-12675-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12675-01

Size / count 50 μL

Specifications

Catalog number: RN-12675-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Synaptonemal complex protein 3, SCP-3
Gene Name: SYCP3
Gene ID: 50511
UniProt: Q8IZU3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SYCP3
Target: PP-2454
Partner Proteins: Synaptonemal complex protein 3; SCP-3
Clone: KBL006_7C9
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 68%, Rat - 68%, Pig - 80%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: KSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 68%
Recombinant Antibody: Yes
IHC Dilution: 1:500~1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: SCP3
Target Alternative Name: SYCP3
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Synaptonemal complex protein 3
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SYCP3 Antibody?

The catalog number for Recombinant SYCP3 Antibody is RN-12675.

What sizes are available for Recombinant SYCP3 Antibody?

Recombinant SYCP3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SYCP3 Antibody come in?

Recombinant SYCP3 Antibody is available in 3 different pack sizes.

Is Recombinant SYCP3 Antibody in stock?

Recombinant SYCP3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.