Recombinant ARCN1 Antibody — image 1 of 2

Product details

Recombinant ARCN1 Antibody

Catalog number RN-14496-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14496-01

Size / count 50 μL

Specifications

Catalog number: RN-14496-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Coatomer subunit delta, Archain, Delta-coat protein, Delta-COP
Gene Name: ARCN1
Gene ID: 372
UniProt: P48444
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ARCN1
Target: PP-4881
Partner Proteins: Coatomer subunit delta; Archain; Delta-coat protein; Delta-COP
Clone: KCA013_15F4
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: KITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Yes
IHC Dilution: 1:1000~1:2000
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: COPD
Target Alternative Name: ARCN1
Host or Source: Mouse
Protein Name: Archain 1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ARCN1 Antibody?

The catalog number for Recombinant ARCN1 Antibody is RN-14496.

What sizes are available for Recombinant ARCN1 Antibody?

Recombinant ARCN1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ARCN1 Antibody come in?

Recombinant ARCN1 Antibody is available in 3 different pack sizes.

Is Recombinant ARCN1 Antibody in stock?

Recombinant ARCN1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.