Recombinant MID1IP1 Antibody

Catalog number RN-9269-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-9269-01

Size / count 50 μL

Specifications

Catalog number: RN-9269-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Mid1-interacting protein 1, Gastrulation-specific G12-like protein, Mid1-interacting G12-like protein, Protein STRAIT11499, Spot 14-related protein, S14R, Spot 14-R
Gene Name: MID1IP1
Gene ID: 58526
UniProt: Q9NPA3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MID1IP1
Target: PP-8315
Partner Proteins: Mid1-interacting protein 1; Gastrulation-specific G12-like protein; Mid1-interacting G12-like protein; Protein STRAIT11499; Spot 14-related protein; S14R; Spot 14-R
Clone: K1H033_11H7
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 86%, Pig - 93%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: KHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 85%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MIG12
Target Alternative Name: MID1IP1
Host or Source: Mouse
Protein Name: MID1 interacting protein 1
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant MID1IP1 Antibody?

The catalog number for Recombinant MID1IP1 Antibody is RN-9269.

What sizes are available for Recombinant MID1IP1 Antibody?

Recombinant MID1IP1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant MID1IP1 Antibody come in?

Recombinant MID1IP1 Antibody is available in 3 different pack sizes.

Is Recombinant MID1IP1 Antibody in stock?

Recombinant MID1IP1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

All Products