Recombinant GALNT2 Antibody

Catalog number RN-14590-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14590-01

Size / count 50 μL

Specifications

Catalog number: RN-14590-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Polypeptide N-acetylgalactosaminyltransferase 2, Polypeptide GalNAc transferase 2, GalNAc-T2, pp-GaNTase 2, Protein-UDP acetylgalactosaminyltransferase 2, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2) [Cleaved into: Polypeptide N-acetylgalactosaminyltransferase 2 soluble form]
Gene Name: GALNT2
Gene ID: 2590
UniProt: Q10471
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GALNT2
Target: PP-620
Partner Proteins: Polypeptide N-acetylgalactosaminyltransferase 2; Polypeptide GalNAc transferase 2; GalNAc-T2; pp-GaNTase 2; Protein-UDP acetylgalactosaminyltransferase 2; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2) [Cleaved into: Polypeptide N-acetylgalactosaminyltransferase 2 soluble form]
Clone: K9N049_16D6
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Pig - 95%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: LAGGAGGGAGRKEDWNEIDPIKKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Yes
IHC Dilution: 1:1000~1:2000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: GALNT2
Host or Source: Mouse
Protein Name: Polypeptide N-acetylgalactosaminyltransferase 2
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant GALNT2 Antibody?

The catalog number for Recombinant GALNT2 Antibody is RN-14590.

What sizes are available for Recombinant GALNT2 Antibody?

Recombinant GALNT2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant GALNT2 Antibody come in?

Recombinant GALNT2 Antibody is available in 3 different pack sizes.

Is Recombinant GALNT2 Antibody in stock?

Recombinant GALNT2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

All Products