Recombinant FKBPL Antibody

Catalog number RN-12417-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12417-01

Size / count 50 μL

Specifications

Catalog number: RN-12417-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: FK506-binding protein-like, WAF-1/CIP1 stabilizing protein 39, WISp39
Gene Name: FKBPL
Gene ID: 63943
UniProt: Q9UIM3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FKBPL
Target: PP-421
Partner Proteins: FK506-binding protein-like; WAF-1/CIP1 stabilizing protein 39; WISp39
Clone: K52073_1H5
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 57%, Rat - 62%, Pig - 71%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: EKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 57%
Recombinant Antibody: Yes
WB Dilution: 1:2000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: DIR1; NG7
Target Alternative Name: FKBPL
Host or Source: Mouse
Protein Name: FKBP prolyl isomerase like
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant FKBPL Antibody?

The catalog number for Recombinant FKBPL Antibody is RN-12417.

What sizes are available for Recombinant FKBPL Antibody?

Recombinant FKBPL Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant FKBPL Antibody come in?

Recombinant FKBPL Antibody is available in 3 different pack sizes.

Is Recombinant FKBPL Antibody in stock?

Recombinant FKBPL Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.