Recombinant ECPAS Antibody

Catalog number RN-12777-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12777-01

Size / count 50 μL

Specifications

Catalog number: RN-12777-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proteasome adapter and scaffold protein ECM29, Ecm29 proteasome adapter and scaffold, Proteasome-associated protein ECM29 homolog
Gene Name: ECPAS
Gene ID: 23392
UniProt: Q5VYK3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ECPAS
Target: PP-5879
Partner Proteins: Proteasome adapter and scaffold protein ECM29; Ecm29 proteasome adapter and scaffold; Proteasome-associated protein ECM29 homolog
Clone: K92087_10A12
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Pig - 95%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: GVRTTKNEEENEKEKELQLEYLLGAFESLGKAWPRNAETQRCYRQELCKLMCERLKLSTWKVQLGVLQSMNAFFQGLMLLEEEHADPEALAEILLETCKS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Yes
WB Dilution: 1:4000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ECM29; KIAA0368
Target Alternative Name: ECPAS
Host or Source: Mouse
Protein Name: Ecm29 proteasome adaptor and scaffold
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ECPAS Antibody?

The catalog number for Recombinant ECPAS Antibody is RN-12777.

What sizes are available for Recombinant ECPAS Antibody?

Recombinant ECPAS Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ECPAS Antibody come in?

Recombinant ECPAS Antibody is available in 3 different pack sizes.

Is Recombinant ECPAS Antibody in stock?

Recombinant ECPAS Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

All Products