Recombinant KLHL41 Antibody

Catalog number RN-14630-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14630-01

Size / count 50 μL

Specifications

Catalog number: RN-14630-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Kelch-like protein 41, Kel-like protein 23, Kelch repeat and BTB domain-containing protein 10, Kelch-related protein 1, Sarcosin
Gene Name: KLHL41
Gene ID: 10324
UniProt: O60662
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human KLHL41
Target: PP-4245
Partner Proteins: Kelch-like protein 41; Kel-like protein 23; Kelch repeat and BTB domain-containing protein 10; Kelch-related protein 1; Sarcosin
Clone: K94092_7A1
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 98%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: LRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQDIFALASRFQIPSVFTVCVSYLQKRLAPGNCLAILRLGLLLDCPRLAISAREFVSDRFVQICKEEDFMQLSPQELISVISNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVVGGLYVDEENKDQPLQSYFFQLDSIASEWVG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: KBTBD10; KRP1
Target Alternative Name: KLHL41
Panel Description: E3 Ligase, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Kelch like family member 41
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant KLHL41 Antibody?

The catalog number for Recombinant KLHL41 Antibody is RN-14630.

What sizes are available for Recombinant KLHL41 Antibody?

Recombinant KLHL41 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant KLHL41 Antibody come in?

Recombinant KLHL41 Antibody is available in 3 different pack sizes.

Is Recombinant KLHL41 Antibody in stock?

Recombinant KLHL41 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.