Recombinant PRKAG3 Antibody

Catalog number RN-14515-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14515-01

Size / count 50 μL

Specifications

Catalog number: RN-14515-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: 5'-AMP-activated protein kinase subunit gamma-3, AMPK gamma3, AMPK subunit gamma-3
Gene Name: PRKAG3
Gene ID: 53632
UniProt: Q9UGI9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKAG3
Target: PP-4159
Partner Proteins: 5'-AMP-activated protein kinase subunit gamma-3; AMPK gamma3; AMPK subunit gamma-3
Clone: K92097_11B10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 68%, Pig - 69%, Cynomolgus monkey - 90%
Purity: ≥85%
Cores: RTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSDCTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPGAQIYMRFMQE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 68%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AMPKG3
Target Alternative Name: PRKAG3
Host or Source: Mouse
Protein Name: Protein kinase AMP-activated non-catalytic subunit gamma 3
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant PRKAG3 Antibody?

The catalog number for Recombinant PRKAG3 Antibody is RN-14515.

What sizes are available for Recombinant PRKAG3 Antibody?

Recombinant PRKAG3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PRKAG3 Antibody come in?

Recombinant PRKAG3 Antibody is available in 3 different pack sizes.

Is Recombinant PRKAG3 Antibody in stock?

Recombinant PRKAG3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

All Products