SETBP1 Antibody (Biotin)

Catalog number KB-7801-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7801-01

Size / count 50 μL

Specifications

Catalog number: KB-7801-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: SET-binding protein, SEB
Gene Name: SETBP1
Gene ID: 26040
UniProt: Q9Y6X0
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SETBP1
Target: PP-1046
Partner Proteins: SET-binding protein; SEB
Clone: K1E066_14D3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 88%, Pig - 92%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: PPPQFHTNSHVKMSGAAKHKAKHGVHLQGPVSMGLGDMQPSLNPPKVGSASLSSGRLHKRKHKHKHKHKEDRILGTHDNLSGLFAGKATGFSSHILSERLSSADKELPLVSEKNKHKEKQKHQHSEAGHKASKNNFEVDTLSTLSLSDAQHWTQAKEKGDLSSEPVDSCT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 88%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KIAA0437
Target Alternative Name: SETBP1
Panel Description: DNA binding & Chromatin, Transcription Factors
Host or Source: Mouse
Protein Name: SET binding protein 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG3

Frequently Asked Questions

What is the catalog number for SETBP1 Antibody (Biotin)?

The catalog number for SETBP1 Antibody (Biotin) is KB-7801.

What sizes are available for SETBP1 Antibody (Biotin)?

SETBP1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SETBP1 Antibody (Biotin) come in?

SETBP1 Antibody (Biotin) is available in 3 different pack sizes.

Is SETBP1 Antibody (Biotin) in stock?

SETBP1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.