Recombinant HS3ST3B1 Antibody

Catalog number RN-12579-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12579-01

Size / count 50 μL

Specifications

Catalog number: RN-12579-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Heparan sulfate glucosamine 3-O-sulfotransferase 3B1, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1, 3-OST-3B, Heparan sulfate 3-O-sulfotransferase 3B1, h3-OST-3B
Gene Name: HS3ST3B1
Gene ID: 9953
UniProt: Q9Y662
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human HS3ST3B1
Target: PP-1529
Partner Proteins: Heparan sulfate glucosamine 3-O-sulfotransferase 3B1; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1; 3-OST-3B; Heparan sulfate 3-O-sulfotransferase 3B1; h3-OST-3B
Clone: K24057_20D7
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 77%, Pig - 87%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: PDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPDSPSPISSFFSGSGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: 3OST3B1; HS3ST3B
Target Alternative Name: HS3ST3B1
Host or Source: Mouse
Protein Name: Heparan sulfate-glucosamine 3-sulfotransferase 3B1
WB Description: Succeed
IP description: Fail (Mouse Brain)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant HS3ST3B1 Antibody?

The catalog number for Recombinant HS3ST3B1 Antibody is RN-12579.

What sizes are available for Recombinant HS3ST3B1 Antibody?

Recombinant HS3ST3B1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant HS3ST3B1 Antibody come in?

Recombinant HS3ST3B1 Antibody is available in 3 different pack sizes.

Is Recombinant HS3ST3B1 Antibody in stock?

Recombinant HS3ST3B1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products