IRAKM Antibody (Biotin)

Catalog number KB-28088-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-28088-01

Size / count 50 μL

Specifications

Catalog number: KB-28088-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-1 receptor-associated kinase 3, IRAK-3, IL-1 receptor-associated kinase M, IRAK-M, Inactive IL-1 receptor-associated kinase 3
Gene Name: IRAK3
Gene ID: 11213
UniProt: Q9Y616
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IRAK3
Target: PP-10821
Partner Proteins: Interleukin-1 receptor-associated kinase 3; IRAK-3; IL-1 receptor-associated kinase M; IRAK-M; Inactive IL-1 receptor-associated kinase 3
Clone: K40089_2C2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Pig - 73%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: KSFRCPSPLFLENVPSIPVEDDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 72%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: IRAKM
Host or Source: Mouse
Protein Name: Interleukin 1 receptor associated kinase 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for IRAKM Antibody (Biotin)?

The catalog number for IRAKM Antibody (Biotin) is KB-28088.

What sizes are available for IRAKM Antibody (Biotin)?

IRAKM Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IRAKM Antibody (Biotin) come in?

IRAKM Antibody (Biotin) is available in 3 different pack sizes.

Is IRAKM Antibody (Biotin) in stock?

IRAKM Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

All Products