CHST2 Antibody (Biotin)

Catalog number KB-26648-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-26648-01

Size / count 50 μL

Specifications

Catalog number: KB-26648-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Carbohydrate sulfotransferase 2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2, GST-2, N-acetylglucosamine 6-O-sulfotransferase 1, GlcNAc6ST-1, Gn6ST-1
Gene Name: CHST2
Gene ID: 9435
UniProt: Q9Y4C5
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CHST2
Target: P09574PAD
Partner Proteins: Carbohydrate sulfotransferase 2; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2; GST-2; N-acetylglucosamine 6-O-sulfotransferase 1; GlcNAc6ST-1; Gn6ST-1
Clone: K56047_3F9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%
Purity: ≥85%
Cores: EPLQQCNPDGPLGAAAGAAGGSWGRPGPPPAGPPRAHARLDLRTPYRPPAAAVGAAPAAAAGMAGVAAPPGNGTRGTGGVGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: GN6ST
Target Alternative Name: CHST2
Host or Source: Mouse
Protein Name: Carbohydrate sulfotransferase 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for CHST2 Antibody (Biotin)?

The catalog number for CHST2 Antibody (Biotin) is KB-26648.

What sizes are available for CHST2 Antibody (Biotin)?

CHST2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CHST2 Antibody (Biotin) come in?

CHST2 Antibody (Biotin) is available in 3 different pack sizes.

Is CHST2 Antibody (Biotin) in stock?

CHST2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.