KDM3A Antibody (Biotin)

Catalog number KB-7465-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7465-01

Size / count 50 μL

Specifications

Catalog number: KB-7465-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Lysine-specific demethylase 3A, JmjC domain-containing histone demethylation protein 2A, Jumonji domain-containing protein 1A, [histone H3]-dimethyl-L-lysine (9) demethylase 3A
Gene Name: KDM3A
Gene ID: 55818
UniProt: Q9Y4C1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human KDM3A
Target: PP-1157
Partner Proteins: Lysine-specific demethylase 3A; JmjC domain-containing histone demethylation protein 2A; Jumonji domain-containing protein 1A; [histone H3]-dimethyl-L-lysine (9) demethylase 3A
Clone: K52055_8C3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 88%, Rat - 88%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VDNESCCSRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIVAQLPKCRECRLDSLRKDKEQQKDSPVFCRF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 88%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: JHDM2A; JMJD1; JMJD1A; KIAA0742; TSGA
Target Alternative Name: KDM3A
Panel Description: DNA binding & Chromatin
Host or Source: Mouse
Protein Name: Lysine demethylase 3A
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for KDM3A Antibody (Biotin)?

The catalog number for KDM3A Antibody (Biotin) is KB-7465.

What sizes are available for KDM3A Antibody (Biotin)?

KDM3A Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does KDM3A Antibody (Biotin) come in?

KDM3A Antibody (Biotin) is available in 3 different pack sizes.

Is KDM3A Antibody (Biotin) in stock?

KDM3A Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.