SIT1 Antibody (Biotin)

Catalog number KB-3648-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3648-01

Size / count 50 μL

Specifications

Catalog number: KB-3648-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Signaling threshold-regulating transmembrane adapter 1, SHP2-interacting transmembrane adapter protein, Suppression-inducing transmembrane adapter 1, gp30/40
Gene Name: SIT1
Gene ID: 27240
UniProt: Q9Y3P8
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SIT1
Target: PP-1545
Partner Proteins: Signaling threshold-regulating transmembrane adapter 1; SHP2-interacting transmembrane adapter protein; Suppression-inducing transmembrane adapter 1; gp30/40
Clone: K9N006_15D2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 78%, Rat - 79%, Pig - 87%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: SRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYAN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 78%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: SIT
Target Alternative Name: SIT1
Host or Source: Mouse
Protein Name: Signaling threshold regulating transmembrane adaptor 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for SIT1 Antibody (Biotin)?

The catalog number for SIT1 Antibody (Biotin) is KB-3648.

What sizes are available for SIT1 Antibody (Biotin)?

SIT1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SIT1 Antibody (Biotin) come in?

SIT1 Antibody (Biotin) is available in 3 different pack sizes.

Is SIT1 Antibody (Biotin) in stock?

SIT1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

All Products