SIGLEC7 Antibody (Biotin)

Catalog number KB-3662-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3662-01

Size / count 50 μL

Specifications

Catalog number: KB-3662-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Sialic acid-binding Ig-like lectin 7, Siglec-7, Adhesion inhibitory receptor molecule 1, AIRM-1, CDw328, D-siglec, QA79 membrane protein, p75, CD antigen CD328
Gene Name: SIGLEC7
Gene ID: 27036
UniProt: Q9Y286
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SIGLEC7
Target Antigen: CD328
Target: PP-1188
Partner Proteins: Sialic acid-binding Ig-like lectin 7; Siglec-7; Adhesion inhibitory receptor molecule 1; AIRM-1; CDw328; D-siglec; QA79 membrane protein; p75; CD antigen CD328
Clone: K70050_1D9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 45%, Cynomolgus monkey - 66%
Purity: ≥85%
Cores: KKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPRHHGLAAHSSGEEREIQYAPLSFHKGEPQDLSGQEATNNEY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 45%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: AIRM1
Target Alternative Name: SIGLEC7
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Sialic acid binding Ig like lectin 7
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for SIGLEC7 Antibody (Biotin)?

The catalog number for SIGLEC7 Antibody (Biotin) is KB-3662.

What sizes are available for SIGLEC7 Antibody (Biotin)?

SIGLEC7 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SIGLEC7 Antibody (Biotin) come in?

SIGLEC7 Antibody (Biotin) is available in 3 different pack sizes.

Is SIGLEC7 Antibody (Biotin) in stock?

SIGLEC7 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.