LAMP3 Antibody (Biotin)

Catalog number KB-9734-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-9734-01

Size / count 50 μL

Specifications

Catalog number: KB-9734-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Lysosome-associated membrane glycoprotein 3, LAMP-3, Lysosomal-associated membrane protein 3, DC-lysosome-associated membrane glycoprotein, DC LAMP, Protein TSC403, CD antigen CD208
Gene Name: LAMP3
Gene ID: 27074
UniProt: Q9UQV4
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LAMP3
Target Antigen: CD208
Target: PP-1456
Partner Proteins: Lysosome-associated membrane glycoprotein 3; LAMP-3; Lysosomal-associated membrane protein 3; DC-lysosome-associated membrane glycoprotein; DC LAMP; Protein TSC403; CD antigen CD208
Clone: K24013_15H12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 52%, Rat - 48%, Pig - 77%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: TVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 52%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: DCLAMP; TSC403
Target Alternative Name: LAMP3
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Lysosomal associated membrane protein 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for LAMP3 Antibody (Biotin)?

The catalog number for LAMP3 Antibody (Biotin) is KB-9734.

What sizes are available for LAMP3 Antibody (Biotin)?

LAMP3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does LAMP3 Antibody (Biotin) come in?

LAMP3 Antibody (Biotin) is available in 3 different pack sizes.

Is LAMP3 Antibody (Biotin) in stock?

LAMP3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.