LAMP3 Antibody (Biotin)

Catalog number KB-9736-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-9736-01

Size / count 50 μL

Specifications

Catalog number: KB-9736-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Lysosome-associated membrane glycoprotein 3, LAMP-3, Lysosomal-associated membrane protein 3, DC-lysosome-associated membrane glycoprotein, DC LAMP, Protein TSC403, CD antigen CD208
Gene Name: LAMP3
Gene ID: 27074
UniProt: Q9UQV4
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LAMP3
Target Antigen: CD208
Target: PP-1456
Partner Proteins: Lysosome-associated membrane glycoprotein 3; LAMP-3; Lysosomal-associated membrane protein 3; DC-lysosome-associated membrane glycoprotein; DC LAMP; Protein TSC403; CD antigen CD208
Clone: K24013_17A12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 52%, Rat - 48%, Pig - 77%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: TVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 52%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: DCLAMP; TSC403
Target Alternative Name: LAMP3
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Lysosomal associated membrane protein 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for LAMP3 Antibody (Biotin)?

The catalog number for LAMP3 Antibody (Biotin) is KB-9736.

What sizes are available for LAMP3 Antibody (Biotin)?

LAMP3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does LAMP3 Antibody (Biotin) come in?

LAMP3 Antibody (Biotin) is available in 3 different pack sizes.

Is LAMP3 Antibody (Biotin) in stock?

LAMP3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

All Products