Recombinant ZFR2 Antibody

Catalog number RN-11882-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-11882-01

Size / count 50 μL

Specifications

Catalog number: RN-11882-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Zinc finger RNA-binding protein 2
Gene Name: ZFR2
Gene ID: 23217
UniProt: Q9UPR6
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ZFR2
Target: PP-9544
Partner Proteins: Zinc finger RNA-binding protein 2
Clone: K1E059_10C4
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Pig - 46%, Cynomolgus monkey - 92%
Purity: ≥85%
Cores: AALQSGRMTAADSGQPGTQEACGQPSPHGSHSHAQPPQQAPIVESGQPASTLSSGYTYPTATGVQPESSASIVTSYPPPSYNPTCTAYTAPSYPNYDASVYSAASPFYPPAQPPPPPGPPQQLPPPPAPAGSGSSPRADSKPPLPSKLPR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: KIAA1086
Target Alternative Name: ZFR2
Host or Source: Mouse
Protein Name: Zinc finger RNA binding protein 2
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ZFR2 Antibody?

The catalog number for Recombinant ZFR2 Antibody is RN-11882.

What sizes are available for Recombinant ZFR2 Antibody?

Recombinant ZFR2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ZFR2 Antibody come in?

Recombinant ZFR2 Antibody is available in 3 different pack sizes.

Is Recombinant ZFR2 Antibody in stock?

Recombinant ZFR2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

All Products