ADAMTS8 Antibody (Biotin)

Catalog number KB-3316-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3316-01

Size / count 50 μL

Specifications

Catalog number: KB-3316-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: A disintegrin and metalloproteinase with thrombospondin motifs 8, ADAM-TS 8, ADAM-TS8, ADAMTS-8, METH-2, METH-8
Gene Name: ADAMTS8
Gene ID: 11095
UniProt: Q9UP79
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ADAMTS8
Target: PP-1822
Partner Proteins: A disintegrin and metalloproteinase with thrombospondin motifs 8; ADAM-TS 8; ADAM-TS8; ADAMTS-8; METH-2; METH-8
Clone: K1H012_15D2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 75%, Rat - 48%, Pig - 92%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: GRMALYQLDQQCRQIFGPDFRHCPNTSAQDVCAQLWCHTDGAEPLCHTKNGSLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVADGGWAPWGPWGECSRTCGGGVQFSHRECKDPEPQNGGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 75%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: METH2
Target Alternative Name: ADAMTS8
Host or Source: Mouse
Protein Name: ADAM metallopeptidase with thrombospondin type 1 motif 8
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for ADAMTS8 Antibody (Biotin)?

The catalog number for ADAMTS8 Antibody (Biotin) is KB-3316.

What sizes are available for ADAMTS8 Antibody (Biotin)?

ADAMTS8 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ADAMTS8 Antibody (Biotin) come in?

ADAMTS8 Antibody (Biotin) is available in 3 different pack sizes.

Is ADAMTS8 Antibody (Biotin) in stock?

ADAMTS8 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

All Products