Recombinant CORO1C Antibody

Catalog number RN-14070-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14070-01

Size / count 50 μL

Specifications

Catalog number: RN-14070-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Coronin-1C, Coronin-3, hCRNN4
Gene Name: CORO1C
Gene ID: 23603
UniProt: Q9ULV4
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CORO1C
Target: PP-4578
Partner Proteins: Coronin-1C; Coronin-3; hCRNN4
Clone: K9N043_3G5
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 50%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: PRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CRN2; CRNN4
Target Alternative Name: CORO1C
Host or Source: Mouse
Protein Name: Coronin 1C
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CORO1C Antibody?

The catalog number for Recombinant CORO1C Antibody is RN-14070.

What sizes are available for Recombinant CORO1C Antibody?

Recombinant CORO1C Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CORO1C Antibody come in?

Recombinant CORO1C Antibody is available in 3 different pack sizes.

Is Recombinant CORO1C Antibody in stock?

Recombinant CORO1C Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

All Products