Recombinant CHORDC1 Antibody

Catalog number RN-14669-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14669-01

Size / count 50 μL

Specifications

Catalog number: RN-14669-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cysteine and histidine-rich domain-containing protein 1, CHORD domain-containing protein 1, CHORD-containing protein 1, CHP-1, Protein morgana
Gene Name: CHORDC1
Gene ID: 26973
UniProt: Q9UHD1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CHORDC1
Target: PP-5524
Partner Proteins: Cysteine and histidine-rich domain-containing protein 1; CHORD domain-containing protein 1; CHORD-containing protein 1; CHP-1; Protein morgana
Clone: K8U060_14F9
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: GQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CHP1
Target Alternative Name: CHORDC1
Host or Source: Mouse
Protein Name: Cysteine and histidine rich domain containing 1
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CHORDC1 Antibody?

The catalog number for Recombinant CHORDC1 Antibody is RN-14669.

What sizes are available for Recombinant CHORDC1 Antibody?

Recombinant CHORDC1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CHORDC1 Antibody come in?

Recombinant CHORDC1 Antibody is available in 3 different pack sizes.

Is Recombinant CHORDC1 Antibody in stock?

Recombinant CHORDC1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.