Recombinant PSMC3IP Antibody

Catalog number RN-12917-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12917-01

Size / count 50 μL

Specifications

Catalog number: RN-12917-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Homologous-pairing protein 2 homolog, Nuclear receptor coactivator GT198, PSMC3-interacting protein, Proteasome 26S ATPase subunit 3-interacting protein, Tat-binding protein 1-interacting protein, TBP-1-interacting protein
Gene Name: PSMC3IP
Gene ID: 29893
UniProt: Q9P2W1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PSMC3IP
Target: PP-10133
Partner Proteins: Homologous-pairing protein 2 homolog; Nuclear receptor coactivator GT198; PSMC3-interacting protein; Proteasome 26S ATPase subunit 3-interacting protein; Tat-binding protein 1-interacting protein; TBP-1-interacting protein
Clone: K1E058_19B10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 89%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTTPEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: HOP2; TBPIP
Target Alternative Name: PSMC3IP
Host or Source: Mouse
Protein Name: PSMC3 interacting protein
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant PSMC3IP Antibody?

The catalog number for Recombinant PSMC3IP Antibody is RN-12917.

What sizes are available for Recombinant PSMC3IP Antibody?

Recombinant PSMC3IP Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PSMC3IP Antibody come in?

Recombinant PSMC3IP Antibody is available in 3 different pack sizes.

Is Recombinant PSMC3IP Antibody in stock?

Recombinant PSMC3IP Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.