IL37 Antibody (Biotin)

Catalog number KB-3017-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3017-01

Size / count 50 μL

Specifications

Catalog number: KB-3017-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-37, IL-37, FIL1 zeta, IL-1X, Interleukin-1 family member 7, IL-1F7, Interleukin-1 homolog 4, IL-1H, IL-1H4, Interleukin-1 zeta, IL-1 zeta, Interleukin-1-related protein, IL-1RP1
Gene Name: IL37
Gene ID: 27178
UniProt: Q9NZH6
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL37
Target: PP-1813
Partner Proteins: Interleukin-37; IL-37; FIL1 zeta; IL-1X; Interleukin-1 family member 7; IL-1F7; Interleukin-1 homolog 4; IL-1H; IL-1H4; Interleukin-1 zeta; IL-1 zeta; Interleukin-1-related protein; IL-1RP1
Clone: K92047_6E6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 32%, Pig - 39%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: KVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 32%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: FIL1Z; IL1F7; IL1H4; IL1RP1
Target Alternative Name: IL37
Panel Description: Cytokines, Ferroptosis
Host or Source: Mouse
Protein Name: Interleukin 37
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for IL37 Antibody (Biotin)?

The catalog number for IL37 Antibody (Biotin) is KB-3017.

What sizes are available for IL37 Antibody (Biotin)?

IL37 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL37 Antibody (Biotin) come in?

IL37 Antibody (Biotin) is available in 3 different pack sizes.

Is IL37 Antibody (Biotin) in stock?

IL37 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

All Products