PAG1 Antibody (Biotin)

Catalog number KB-7479-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7479-01

Size / count 50 μL

Specifications

Catalog number: KB-7479-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Phosphoprotein associated with glycosphingolipid-enriched microdomains 1, Csk-binding protein, Transmembrane adapter protein PAG, Transmembrane phosphoprotein Cbp
Gene Name: PAG1
Gene ID: 55824
UniProt: Q9NWQ8
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PAG1
Target: PP-1002
Partner Proteins: Phosphoprotein associated with glycosphingolipid-enriched microdomains 1; Csk-binding protein; Transmembrane adapter protein PAG; Transmembrane phosphoprotein Cbp
Clone: K1E042_19F5
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 82%, Pig - 90%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: GDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENEN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CBP; PAG
Target Alternative Name: PAG1
Host or Source: Mouse
Protein Name: Phosphoprotein membrane anchor with glycosphingolipid microdomains 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for PAG1 Antibody (Biotin)?

The catalog number for PAG1 Antibody (Biotin) is KB-7479.

What sizes are available for PAG1 Antibody (Biotin)?

PAG1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PAG1 Antibody (Biotin) come in?

PAG1 Antibody (Biotin) is available in 3 different pack sizes.

Is PAG1 Antibody (Biotin) in stock?

PAG1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

All Products