Recombinant MRGBP Antibody

Catalog number RN-14652-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14652-01

Size / count 50 μL

Specifications

Catalog number: RN-14652-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: MRG/MORF4L-binding protein, MRG-binding protein, Up-regulated in colon cancer 4, Urcc4
Gene Name: MRGBP
Gene ID: 55257
UniProt: Q9NV56
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human MRGBP
Target: PP-10421
Partner Proteins: MRG/MORF4L-binding protein; MRG-binding protein; Up-regulated in colon cancer 4; Urcc4
Clone: K24079_19F7
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: RDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C20orf20
Target Alternative Name: MRGBP
Panel Description: DNA binding & Chromatin
Host or Source: Mouse
Protein Name: MRG domain binding protein
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant MRGBP Antibody?

The catalog number for Recombinant MRGBP Antibody is RN-14652.

What sizes are available for Recombinant MRGBP Antibody?

Recombinant MRGBP Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant MRGBP Antibody come in?

Recombinant MRGBP Antibody is available in 3 different pack sizes.

Is Recombinant MRGBP Antibody in stock?

Recombinant MRGBP Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.