Recombinant MRGBP Antibody

Catalog number RN-14651-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14651-01

Size / count 50 μL

Specifications

Catalog number: RN-14651-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: MRG/MORF4L-binding protein, MRG-binding protein, Up-regulated in colon cancer 4, Urcc4
Gene Name: MRGBP
Gene ID: 55257
UniProt: Q9NV56
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MRGBP
Target: PP-10421
Partner Proteins: MRG/MORF4L-binding protein; MRG-binding protein; Up-regulated in colon cancer 4; Urcc4
Clone: K24079_20D11
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: RDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C20orf20
Target Alternative Name: MRGBP
Panel Description: DNA binding & Chromatin
Host or Source: Mouse
Protein Name: MRG domain binding protein
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant MRGBP Antibody?

The catalog number for Recombinant MRGBP Antibody is RN-14651.

What sizes are available for Recombinant MRGBP Antibody?

Recombinant MRGBP Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant MRGBP Antibody come in?

Recombinant MRGBP Antibody is available in 3 different pack sizes.

Is Recombinant MRGBP Antibody in stock?

Recombinant MRGBP Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.