THSD1 Antibody (Biotin)

Catalog number KB-23229-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-23229-01

Size / count 50 μL

Specifications

Catalog number: KB-23229-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Thrombospondin type-1 domain-containing protein 1, Transmembrane molecule with thrombospondin module
Gene Name: THSD1
Gene ID: 55901
UniProt: Q9NS62
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human THSD1
Target: PP-999
Partner Proteins: Thrombospondin type-1 domain-containing protein 1; Transmembrane molecule with thrombospondin module
Clone: K9N025_13F2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Pig - 84%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: GDHQAGLVAGIERTEPHRARRGPSPSHKSVSRKQSSPISPKDNYQRVSSLSPSQCRKDKCQSFPTHPEFAFYDNTSFGLT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: TMTSP
Target Alternative Name: THSD1
Host or Source: Mouse
Protein Name: Thrombospondin type 1 domain containing 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for THSD1 Antibody (Biotin)?

The catalog number for THSD1 Antibody (Biotin) is KB-23229.

What sizes are available for THSD1 Antibody (Biotin)?

THSD1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does THSD1 Antibody (Biotin) come in?

THSD1 Antibody (Biotin) is available in 3 different pack sizes.

Is THSD1 Antibody (Biotin) in stock?

THSD1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.