Recombinant MID1IP1 Antibody

Catalog number RN-14576-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14576-01

Size / count 50 μL

Specifications

Catalog number: RN-14576-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Mid1-interacting protein 1, Gastrulation-specific G12-like protein, Mid1-interacting G12-like protein, Protein STRAIT11499, Spot 14-related protein, S14R, Spot 14-R
Gene Name: MID1IP1
Gene ID: 58526
UniProt: Q9NPA3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MID1IP1
Target: PP-8315
Partner Proteins: Mid1-interacting protein 1; Gastrulation-specific G12-like protein; Mid1-interacting G12-like protein; Protein STRAIT11499; Spot 14-related protein; S14R; Spot 14-R
Clone: K1H033_2F12
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 86%, Pig - 93%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: KHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 85%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MIG12
Target Alternative Name: MID1IP1
Host or Source: Mouse
Protein Name: MID1 interacting protein 1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant MID1IP1 Antibody?

The catalog number for Recombinant MID1IP1 Antibody is RN-14576.

What sizes are available for Recombinant MID1IP1 Antibody?

Recombinant MID1IP1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant MID1IP1 Antibody come in?

Recombinant MID1IP1 Antibody is available in 3 different pack sizes.

Is Recombinant MID1IP1 Antibody in stock?

Recombinant MID1IP1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

All Products