Recombinant SEPSECS Antibody

Catalog number RN-14754-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14754-01

Size / count 50 μL

Specifications

Catalog number: RN-14754-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: O-phosphoseryl-tRNA (Sec) selenium transferase, Liver-pancreas antigen, LP, SLA-p35, SLA/LP autoantigen, Selenocysteine synthase, Sec synthase, Selenocysteinyl-tRNA (Sec) synthase, Sep-tRNA:Sec-tRNA synthase, SepSecS, Soluble liver antigen, SLA, UGA suppressor tRNA-associated protein, tRNA (Ser/Sec) -associated antigenic protein
Gene Name: SEPSECS
Gene ID: 51091
UniProt: Q9HD40
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SEPSECS
Target: PP-10755
Partner Proteins: O-phosphoseryl-tRNA (Sec) selenium transferase; Liver-pancreas antigen; LP; SLA-p35; SLA/LP autoantigen; Selenocysteine synthase; Sec synthase; Selenocysteinyl-tRNA (Sec) synthase; Sep-tRNA:Sec-tRNA synthase; SepSecS; Soluble liver antigen; SLA; UGA suppressor tRNA-associated protein; tRNA (Ser/Sec) -associated antigenic protein
Clone: K9N044_28C1
Conjugation: Unconjugated
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: TAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCILCIHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVQSSKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Yes
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TRNP48
Target Alternative Name: SEPSECS
Panel Description: Autoimmune Disease, Neurodegenerative Diseases Marker
Host or Source: Human
Protein Name: Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Recombinant SEPSECS Antibody?

The catalog number for Recombinant SEPSECS Antibody is RN-14754.

What sizes are available for Recombinant SEPSECS Antibody?

Recombinant SEPSECS Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SEPSECS Antibody come in?

Recombinant SEPSECS Antibody is available in 3 different pack sizes.

Is Recombinant SEPSECS Antibody in stock?

Recombinant SEPSECS Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

All Products