IL21R Antibody (Biotin)

Catalog number KB-23419-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-23419-01

Size / count 50 μL

Specifications

Catalog number: KB-23419-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-21 receptor, IL-21 receptor, IL-21R, Novel interleukin receptor, CD antigen CD360
Gene Name: IL21R
Gene ID: 50615
UniProt: Q9HBE5
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL21R
Target Antigen: CD360
Target: PP-1799
Partner Proteins: Interleukin-21 receptor; IL-21 receptor; IL-21R; Novel interleukin receptor; CD antigen CD360
Clone: K1H011_7A8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Pig - 65%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: YGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: NILR
Target Alternative Name: IL21R
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Interleukin 21 receptor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for IL21R Antibody (Biotin)?

The catalog number for IL21R Antibody (Biotin) is KB-23419.

What sizes are available for IL21R Antibody (Biotin)?

IL21R Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL21R Antibody (Biotin) come in?

IL21R Antibody (Biotin) is available in 3 different pack sizes.

Is IL21R Antibody (Biotin) in stock?

IL21R Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products