SLITRK6 Antibody (Biotin)

Catalog number KB-7806-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7806-01

Size / count 50 μL

Specifications

Catalog number: KB-7806-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: SLIT and NTRK-like protein 6
Gene Name: SLITRK6
Gene ID: 84189
UniProt: Q9H5Y7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SLITRK6
Target: PP-609
Partner Proteins: SLIT and NTRK-like protein 6
Clone: K1H004_13A12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: EEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SLITRK6
Host or Source: Mouse
Protein Name: SLIT and NTRK like family member 6
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for SLITRK6 Antibody (Biotin)?

The catalog number for SLITRK6 Antibody (Biotin) is KB-7806.

What sizes are available for SLITRK6 Antibody (Biotin)?

SLITRK6 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SLITRK6 Antibody (Biotin) come in?

SLITRK6 Antibody (Biotin) is available in 3 different pack sizes.

Is SLITRK6 Antibody (Biotin) in stock?

SLITRK6 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

All Products